PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G084600.1.p
Common NameLOC101767815, SETIT_021160mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family Nin-like
Protein Properties Length: 895aa    MW: 98567.1 Da    PI: 6.4204
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G084600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK85.64.5e-27551601252
              RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ek+ sle++++yF +++k+AAk+Lgvc+T++KriCRq+GI+RWP+R+i+++
  Seita.3G084600.1.p 551 EKTFSLEVIQHYFTGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRQISKV 601
                         8999********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.006540621IPR003035RWP-RK domain
PfamPF020422.1E-23554601IPR003035RWP-RK domain
SuperFamilySSF542777.85E-23790885No hitNo description
SMARTSM006661.7E-25800882IPR000270PB1 domain
PROSITE profilePS5174518.862800882IPR000270PB1 domain
PfamPF005641.6E-17801881IPR000270PB1 domain
CDDcd064073.67E-32801881No hitNo description
Gene3DG3DSA:3.10.20.2403.2E-25801881No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 895 aa     Download sequence    Send to blast
MEFDFDSPDG GDAWLLDAMA TSLHFSAASP PLPPPWPCGD PHHPSVPLDT AALQDDAPGA  60
RAGKSEITKK GEPINGKCQV HLSMVDDYSH SSYFLKEKLT LALRYFKDST NQHLLVQVWV  120
PIRKGDRYML STSGQPFVLD KRSIGLLQYR AVSIMYMFSV DGNNVKDLGL PGRVYKQGVP  180
EWTPNVQYYS ITEYARLNHA ISYNVHGTVA LPVFDPSTKS CIAVVELIMT SKKVNYANEV  240
GKVCKALEAV SLKSTEVVEH PYVQICNEGH HAALVEMLEV LTVIGEELKL PLAQTWVPCK  300
YQNSLVPCGG VKKSCFNIHG SCAQELCIST SDVAFQVIDA HMWGFRDACV EHHLQKGQGV  360
SGKAFILHRP CFCKDVTRFS KMEYPLVHYA RMFGLAGCFS VCLQSAYTGN DDYVLEFFLP  420
PDCRKDDEQK VLLESILALL TQHLHSLHLA TDEGSSEELQ VSAITVINND VQHLNFEGGI  480
HASHESKTNG ILGPDSQKRI VSTEYEMWLS PENDTKCNGK LFVGPKGGCT SDSLLPDNNS  540
KHQVRRRGKA EKTFSLEVIQ HYFTGSLKNA AKSLGVCPTT MKRICRQHGI SRWPSRQISK  600
VNRSISKLKK VIESVEGSES GFTLTSITGP LPVPFSPSNP INIKNGQQTE VIDLSIPSVQ  660
ENRGSSLQSK LLENDDRLGM AIPQQSFLAN LSRQIEREKA SNLRSSSGEP STHSGTSEES  720
CLGSPANKTF VSTLMEPQQN MWKPDSFTQE LFQTQDLLLP GLFVNGSGSS ENCKNHITDA  780
VNEPSVVPLG SLMSADNSGI VTVKARYKED LLRFRFPCSA SIIDLKDEVA KRIQADVGVF  840
DIKYLDDDHE WVKLTCDADL EECMEISRLS GSNVLRLLVT DIAPILGSSC GSTG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960682.10.0PREDICTED: protein NLP3-like isoform X1
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLK3Z3P20.0K3Z3P2_SETIT; Uncharacterized protein
STRINGSi021160m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7